Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF212 Rabbit Polyclonal Antibody (HRP)

ZNF212 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF182, ZNFC150, C2H2-150

UniProt

Q9UDV6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF212

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036388

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GGNBP2 activation kit by CRISPRa
GA112711 1 Kit

Human GGNBP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD11c Antibody[BU15]
E-AB-F1118M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD11c Antibody[BU15]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD11c Antibody[BU15]
E-AB-F1118M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD11c Antibody[BU15]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD11c Antibody[BU15]
E-AB-F1118M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD11c Antibody[BU15]

Sign In for Pricing
View Details
Water Chiller BCHI-205
BCHI-205 Each

Water Chiller BCHI-205

Sign In for Pricing
View Details
Uncoated Mouse Flt3L (FMS-like Tyrosine Kinase 3 Ligand) ELISA Kit
E-UNEL-M0049-01 5x 96 Tests

Uncoated Mouse Flt3L (FMS-like Tyrosine Kinase 3 Ligand) ELISA Kit

Sign In for Pricing
View Details