Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF212 Rabbit Polyclonal Antibody (HRP)

ZNF212 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF182, ZNFC150, C2H2-150

UniProt

Q9UDV6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF212

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_036388

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Traf2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4397404 1.0 µg DNA

Traf2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
DUSP9 (Dual Specificity Protein Phosphatase 9, Mitogen-activated Protein Kinase Phosphatase 4, MAP Kinase Phosphatase 4, MKP-4, MKP4) (MaxLight 405) discontinued
126075-ML405 100 µL

DUSP9 (Dual Specificity Protein Phosphatase 9, Mitogen-activated Protein Kinase Phosphatase 4, MAP Kinase Phosphatase 4, MKP-4, MKP4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PLEK Antibody - C-terminal region
ARP82454_P050-25UL 25 µL

PLEK Antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Mouse SLC6A13 Protein, His (Fc)-Avi-tagged
SLC6A13-8405M 50 µg

Recombinant Mouse SLC6A13 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
PCDHGA2 Double Nickase Plasmid (m2)
sc-430019-NIC-2 20 µg

PCDHGA2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
DDX21 (NM_004728) Human Tagged ORF Clone Lentiviral Particle
RC200917L2V 200 µL

DDX21 (NM_004728) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details