Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF606 Rabbit Polyclonal Antibody (FITC)

ZNF606 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF328

UniProt

Q8WXB4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF606

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WHVEGSLEEGRRATGLPAAQVQEPVTFKDVAVDFTQEEWGQLDLVQRTLY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_079303

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GMFG Antibody Picoband® Fluoro647 Conjugated
A12403-1-Fluoro647 100 µg/Vial

Anti-GMFG Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)
MBS1288884-01 0.05 mg (E-Coli)

Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)
MBS1288884-02 0.2 mg (E-Coli)

Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)
MBS1288884-03 0.05 mg (Yeast)

Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)
MBS1288884-04 0.5 mg (E-Coli)

Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)
MBS1288884-05 0.05 mg (Baculovirus)

Recombinant Human immunodeficiency virus type 1 group N Protein Vpr (vpr)

Sign In for Pricing
View Details