Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLDN17 Rabbit Polyclonal Antibody (HRP)

CLDN17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P56750

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CLDN17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_036263

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COASY Rabbit Monoclonal Antibody [Clone ID: 23GB3095]
TA424666 100 µL

COASY Rabbit Monoclonal Antibody [Clone ID: 23GB3095]

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561162 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR560948 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
FBXO22 Mouse Monoclonal Antibody [Clone ID: OTI1H1]
CF809766 100 µg

FBXO22 Mouse Monoclonal Antibody [Clone ID: OTI1H1]

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (CDH16/1071), CF568 conjugate, 0.1mg/mL
BNC681071-100 1x 100 µL

Ksp-Cadherin / CDH16 (CDH16/1071), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phosphoglucose Isomerase (PGI) Activity Colorimetric Assay Kit
E-BC-K770-M-01 48 T (32 samples)

Phosphoglucose Isomerase (PGI) Activity Colorimetric Assay Kit

Sign In for Pricing
View Details