Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLDN9 Rabbit Polyclonal Antibody (Biotin)

CLDN9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DFNB116

UniProt

O95484

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_066192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CD320 HEK293 Overexpression Lysate
MBS8117602-01 0.3 mg

Rat CD320 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Rat CD320 HEK293 Overexpression Lysate
MBS8117602-02 5x 0.3 mg

Rat CD320 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
HAUS2 3'UTR GFP Stable Cell Line
TU059566 1.0 mL

HAUS2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
AKAP6 (A-kinase Anchor Protein 6, AKAP-6, A-kinase Anchor Protein 100kD, AKAP 100, Protein Kinase A-anchoring Protein 6, PRKA6, mAKAP, AKAP100, KIAA0311) (MaxLight 750) discontinued
123138-ML750 100 µL

AKAP6 (A-kinase Anchor Protein 6, AKAP-6, A-kinase Anchor Protein 100kD, AKAP 100, Protein Kinase A-anchoring Protein 6, PRKA6, mAKAP, AKAP100, KIAA0311) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-gamma Sarcoglycan Rabbit pAb
GB114886-100 100 μL

Anti-gamma Sarcoglycan Rabbit pAb

Sign In for Pricing
View Details
Simian sIL-6R (SolubleInterleukin 6 Receptor) ELISA Kit
ELK11583-01 48 Tests

Simian sIL-6R (SolubleInterleukin 6 Receptor) ELISA Kit

Sign In for Pricing
View Details