Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLDN15 Rabbit Polyclonal Antibody (HRP)

CLDN15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P56746

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_055158

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRF Mouse Monoclonal Antibody
BF8229-01 100 µL

SRF Mouse Monoclonal Antibody

Sign In for Pricing
View Details
SRF Mouse Monoclonal Antibody
BF8229-02 200 µL

SRF Mouse Monoclonal Antibody

Sign In for Pricing
View Details
EFNB1 (Phospho-Tyr317) Antibody
MBS9508587-01 0.05 mL

EFNB1 (Phospho-Tyr317) Antibody

Sign In for Pricing
View Details
EFNB1 (Phospho-Tyr317) Antibody
MBS9508587-02 0.1 mL

EFNB1 (Phospho-Tyr317) Antibody

Sign In for Pricing
View Details
EFNB1 (Phospho-Tyr317) Antibody
MBS9508587-03 5x 0.1 mL

EFNB1 (Phospho-Tyr317) Antibody

Sign In for Pricing
View Details
PTPMT1 (Protein Tyrosine Phosphatase, Mitochondrial 1, PLIP, DUSP23, MOSP, PTEN-like phosphatase, Phosphoinositide lipid phosphatase, Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1)
369616 200 µL

PTPMT1 (Protein Tyrosine Phosphatase, Mitochondrial 1, PLIP, DUSP23, MOSP, PTEN-like phosphatase, Phosphoinositide lipid phosphatase, Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1)

Sign In for Pricing
View Details