Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLDN15 Rabbit Polyclonal Antibody (Biotin)

CLDN15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P56746

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_055158

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Rab GTPase-Binding Effector Protein 1 (RABEP1) ELISA Kit
MBS9923668-01 48 Well

Canine Rab GTPase-Binding Effector Protein 1 (RABEP1) ELISA Kit

Sign In for Pricing
View Details
Canine Rab GTPase-Binding Effector Protein 1 (RABEP1) ELISA Kit
MBS9923668-02 96 Well

Canine Rab GTPase-Binding Effector Protein 1 (RABEP1) ELISA Kit

Sign In for Pricing
View Details
Canine Rab GTPase-Binding Effector Protein 1 (RABEP1) ELISA Kit
MBS9923668-03 5x 96 Well

Canine Rab GTPase-Binding Effector Protein 1 (RABEP1) ELISA Kit

Sign In for Pricing
View Details
Canine Rab GTPase-Binding Effector Protein 1 (RABEP1) ELISA Kit
MBS9923668-04 10x 96 Well

Canine Rab GTPase-Binding Effector Protein 1 (RABEP1) ELISA Kit

Sign In for Pricing
View Details
Anti-Delta (12) -fatty-acid Desaturase FAD2-like Polyclonal Antibody
JN016014-01 50 µg

Anti-Delta (12) -fatty-acid Desaturase FAD2-like Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Delta (12) -fatty-acid Desaturase FAD2-like Polyclonal Antibody
JN016014-02 100 µg

Anti-Delta (12) -fatty-acid Desaturase FAD2-like Polyclonal Antibody

Sign In for Pricing
View Details