Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLDN15 Rabbit Polyclonal Antibody (FITC)

CLDN15 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ42715, MGC19536

UniProt

P56746

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CLDN15

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_055158

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (MaxLight 650)
MBS6226190-01 0.1 mL

HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (MaxLight 650)

Sign In for Pricing
View Details
HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (MaxLight 650)
MBS6226190-02 5x 0.1 mL

HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Creatine Kinase Mb Isoenzyme (Ck-Mb) Elisa Kit
EKC38425 96 Tests

Rabbit Creatine Kinase Mb Isoenzyme (Ck-Mb) Elisa Kit

Sign In for Pricing
View Details
Anti-Hu CD66c PE
MBS1802265-01 100 Tests

Anti-Hu CD66c PE

Sign In for Pricing
View Details
Anti-Hu CD66c PE
MBS1802265-02 5x 100 Tests

Anti-Hu CD66c PE

Sign In for Pricing
View Details
PDGF Receptor α (Phospho Tyr1018) Rabbit Polyclonal Antibody
E28G1995 100 µL

PDGF Receptor α (Phospho Tyr1018) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details