Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ap3b1 Rabbit Polyclonal Antibody (Biotin)

Ap3b1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ap3b1

UniProt

D4AA25

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

121kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

EDM10075

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNE4, ID (KCNE4, Potassium voltage-gated channel subfamily E member 4, MinK-related peptide 3, Minimum potassium ion channel-related peptide 3, Potassium channel subunit beta MiRP3) (PE)
MBS6312400-01 0.2 mL

KCNE4, ID (KCNE4, Potassium voltage-gated channel subfamily E member 4, MinK-related peptide 3, Minimum potassium ion channel-related peptide 3, Potassium channel subunit beta MiRP3) (PE)

Sign In for Pricing
View Details
KCNE4, ID (KCNE4, Potassium voltage-gated channel subfamily E member 4, MinK-related peptide 3, Minimum potassium ion channel-related peptide 3, Potassium channel subunit beta MiRP3) (PE)
MBS6312400-02 5x 0.2 mL

KCNE4, ID (KCNE4, Potassium voltage-gated channel subfamily E member 4, MinK-related peptide 3, Minimum potassium ion channel-related peptide 3, Potassium channel subunit beta MiRP3) (PE)

Sign In for Pricing
View Details
SH3TC1 Conjugated Antibody
C35044 100 µL

SH3TC1 Conjugated Antibody

Sign In for Pricing
View Details
Rag2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4437306 1.0 µg DNA

Rag2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
PKIG Protein Vector (Mouse) (pPM-C-HA)
PV216576 500 ng

PKIG Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Chicken Creatine Kinase, Mitochondrial 1B ELISA Kit
MBS013223 Inquire

Chicken Creatine Kinase, Mitochondrial 1B ELISA Kit

Sign In for Pricing
View Details