Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bmi1 Rabbit Polyclonal Antibody (FITC)

Bmi1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Bmi, Bmi-, Pcgf, Bmi-1, Pcgf4, AW546694

UniProt

P25916

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031578

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pacsin2 ORF Vector (Mouse) (pORF)
ORF053295 1.0 µg DNA

Pacsin2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Lentiviral human RPS11 shRNA (UAS) - Lentiviral human RPS11 shRNA (UAS) plasmid
GTR15092107 1 Vial

Lentiviral human RPS11 shRNA (UAS) - Lentiviral human RPS11 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Esp16 shRNA (m) Lentiviral Particles
sc-144948-V 200 µL

Esp16 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Msgn1 3'UTR Lenti-reporter-Luc Vector
30730086 1.0 µg

Msgn1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Transposase InsE For Insertion Sequence IS3A, Recombinant, E. coli, aa1-99, His-Tag
586594-01 20 µg

Transposase InsE For Insertion Sequence IS3A, Recombinant, E. coli, aa1-99, His-Tag

Sign In for Pricing
View Details
Transposase InsE For Insertion Sequence IS3A, Recombinant, E. coli, aa1-99, His-Tag
586594-02 100 µg

Transposase InsE For Insertion Sequence IS3A, Recombinant, E. coli, aa1-99, His-Tag

Sign In for Pricing
View Details