Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bmi1 Rabbit Polyclonal Antibody (FITC)

Bmi1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Bmi, Bmi-, Pcgf, Bmi-1, Pcgf4, AW546694

UniProt

P25916

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031578

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 1 (KRT1) (NM_006121) Human Tagged Lenti ORF Clone
RC223146L1 10 µg

Cytokeratin 1 (KRT1) (NM_006121) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human PEX5 Pre-designed siRNA Set B
SI012001B 1 Each

Human PEX5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-AQP2 Antibody (Monoclonal, 32A23)
M00935 100 µL

Anti-AQP2 Antibody (Monoclonal, 32A23)

Sign In for Pricing
View Details
Rat GAP (Ras Gtpase Activating Protein) ValidElisa Kit
EK342952 96 Well

Rat GAP (Ras Gtpase Activating Protein) ValidElisa Kit

Sign In for Pricing
View Details
GluR-2 CRISPR Activation Plasmid (m2)
sc-420680-ACT-2 20 µg

GluR-2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
C5orf33 shRNA Plasmid (h)
sc-91939-SH 20 µg

C5orf33 shRNA Plasmid (h)

Sign In for Pricing
View Details