Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM25 Rabbit Polyclonal Antibody (HRP)

TRIM25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EFP, Z147, RNF147, ZNF147

UniProt

Q14258

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human TRIM25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVA

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005073.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-2 (BCL2/782), CF488A conjugate, 0.1mg/mL
BNC880782-500 1x 500 µL

Bcl-2 (BCL2/782), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF488A conjugate, 0.1mg/mL
BNC880018-100 1x 100 µL

Human Kappa Light Chain (L1C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SensiStain™ Anti-CMTM6 Antibody
HY000275 0.1 mL

SensiStain™ Anti-CMTM6 Antibody

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/1845), 0.2mg/mL
BNUB1845-100 1x 100 µL

Aurora B (Proliferation Marker) (AURKB/1845), 0.2mg/mL

Sign In for Pricing
View Details
Bcl-2 (8C8), CF640R conjugate, 0.1mg/mL
BNC400005-100 1x 100 µL

Bcl-2 (8C8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/1844), CF405S conjugate, 0.1mg/mL
BNC041844-500 1x 500 µL

CD79b (B-Cell Marker) (IGB/1844), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details