Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF92 Rabbit Polyclonal Antibody (FITC)

ZNF92 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TF12, HPF12, HTF12, HEL-203

UniProt

Q03936

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ZNF92

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TLTKHKRIHTGEKPYKCEECGKAFKQSSTLTEHKIIHTGEKPYKCEKCGK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3495), 0.2mg/mL
BNUB3495-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3495), 0.2mg/mL

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (PDCD1/2720), Biotin conjugate, 0.1mg/mL
BNCB2720-500 1x 500 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (PDCD1/2720), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (Dendritic Cell Marker) (ITGAX/1284), CF568 conjugate, 0.1mg/mL
BNC681284-500 1x 500 µL

CD11c (Dendritic Cell Marker) (ITGAX/1284), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spastin (Sp 6C6), CF647 conjugate, 0.1mg/mL
BNC473070-100 1x 100 µL

Spastin (Sp 6C6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant LINE 1 ORF1p Monoclonal Antibody
E-AB-81506-01 50 µL

Recombinant LINE 1 ORF1p Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant LINE 1 ORF1p Monoclonal Antibody
E-AB-81506-02 100 µL

Recombinant LINE 1 ORF1p Monoclonal Antibody

Sign In for Pricing
View Details