Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIR Rabbit Polyclonal Antibody (HRP)

PIR Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O00625

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PIR

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003653

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gepirone hydrochloride
T204208-01 10 mg

Gepirone hydrochloride

Sign In for Pricing
View Details
Gepirone hydrochloride
T204208-02 50 mg

Gepirone hydrochloride

Sign In for Pricing
View Details
Anti-CD276 Antibody
M02220-3-50ul 50 µL

Anti-CD276 Antibody

Sign In for Pricing
View Details
Monkey Nuclear factor of activated T-cells 5 ELISA Kit
MBS7278042-01 48 Well

Monkey Nuclear factor of activated T-cells 5 ELISA Kit

Sign In for Pricing
View Details
Monkey Nuclear factor of activated T-cells 5 ELISA Kit
MBS7278042-02 96 Well

Monkey Nuclear factor of activated T-cells 5 ELISA Kit

Sign In for Pricing
View Details
Monkey Nuclear factor of activated T-cells 5 ELISA Kit
MBS7278042-03 5x 96 Well

Monkey Nuclear factor of activated T-cells 5 ELISA Kit

Sign In for Pricing
View Details