Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN12 Rabbit Polyclonal Antibody (HRP)

ZSCAN12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZFP96, ZNF96, ZNF305, ZNF29K1, dJ29K1.2

UniProt

A8K187

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZSCAN12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLRKEGEPSMSLQSMKAQPKYESPELESQQEQVLDVETGNEYGNLKQEVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001034732

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD27 (CD27 Antigen, CD27 Molecule, CD27L Receptor, MGC20393, S152, T-cell Activation Antigen CD27, T14, Tp55, Tumor Necrosis Factor Receptor Superfamily Member 7, TNFRSF7) (MaxLight 650) discontinued
C2379-09G-ML650 100 µL

CD27 (CD27 Antigen, CD27 Molecule, CD27L Receptor, MGC20393, S152, T-cell Activation Antigen CD27, T14, Tp55, Tumor Necrosis Factor Receptor Superfamily Member 7, TNFRSF7) (MaxLight 650) discontinued

Sign In for Pricing
View Details
CTRP3 Polyclonal Antibody
MBS9234992-01 0.1 mL

CTRP3 Polyclonal Antibody

Sign In for Pricing
View Details
CTRP3 Polyclonal Antibody
MBS9234992-02 5x 0.1 mL

CTRP3 Polyclonal Antibody

Sign In for Pricing
View Details
USP10 Rabbit pAb
MBS8543564-01 0.1 mL

USP10 Rabbit pAb

Sign In for Pricing
View Details
USP10 Rabbit pAb
MBS8543564-02 0.1 mL (AF405L)

USP10 Rabbit pAb

Sign In for Pricing
View Details
USP10 Rabbit pAb
MBS8543564-03 0.1 mL (AF405S)

USP10 Rabbit pAb

Sign In for Pricing
View Details