Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF592 Rabbit Polyclonal Antibody (HRP)

ZNF592 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAMOS, SCAR5

UniProt

Q92610

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence PGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

138 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_055445

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Hcrt Pre-designed siRNA Set A
SI206140A 1 Each

Rat Hcrt Pre-designed siRNA Set A

Sign In for Pricing
View Details
Gm13178 Rabbit Polyclonal Antibody (Biotin)
orb2118916 100 µL

Gm13178 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Pelodictyon luteolum Lipoprotein-releasing system ATP-binding protein LolD 1 (lolD1)
MBS1476201-01 0.02 mg (E-Coli)

Recombinant Pelodictyon luteolum Lipoprotein-releasing system ATP-binding protein LolD 1 (lolD1)

Sign In for Pricing
View Details
Recombinant Pelodictyon luteolum Lipoprotein-releasing system ATP-binding protein LolD 1 (lolD1)
MBS1476201-02 0.1 mg (E-Coli)

Recombinant Pelodictyon luteolum Lipoprotein-releasing system ATP-binding protein LolD 1 (lolD1)

Sign In for Pricing
View Details
Recombinant Pelodictyon luteolum Lipoprotein-releasing system ATP-binding protein LolD 1 (lolD1)
MBS1476201-03 0.02 mg (Yeast)

Recombinant Pelodictyon luteolum Lipoprotein-releasing system ATP-binding protein LolD 1 (lolD1)

Sign In for Pricing
View Details
Recombinant Pelodictyon luteolum Lipoprotein-releasing system ATP-binding protein LolD 1 (lolD1)
MBS1476201-04 0.1 mg (Yeast)

Recombinant Pelodictyon luteolum Lipoprotein-releasing system ATP-binding protein LolD 1 (lolD1)

Sign In for Pricing
View Details