Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLOCK Rabbit Polyclonal Antibody (FITC)

CLOCK Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KAT13D, bHLHe8

UniProt

O15516

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CLOCK

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004889

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSTA3 Antibody (HRP)
orb239947-01 50 µg

TSTA3 Antibody (HRP)

Sign In for Pricing
View Details
TSTA3 Antibody (HRP)
orb239947-02 100 µg

TSTA3 Antibody (HRP)

Sign In for Pricing
View Details
BACE2, Asp1, NT, Blocking Peptide (Beta-site APP Cleaving Enzyme, Aspartyl Protease 2, DRAP, Down Region Aspartic Protease, Memapsin)
B0003P 50 µg

BACE2, Asp1, NT, Blocking Peptide (Beta-site APP Cleaving Enzyme, Aspartyl Protease 2, DRAP, Down Region Aspartic Protease, Memapsin)

Sign In for Pricing
View Details
MDA-MB-361 (L15) Cell Complete Medium
CM-0553 4x 125 mL

MDA-MB-361 (L15) Cell Complete Medium

Sign In for Pricing
View Details
Human Gamma Enolase Antibody IgG,GE-IgG ELISA KIT
JOT-EKD0192Hu 96 wells

Human Gamma Enolase Antibody IgG,GE-IgG ELISA KIT

Sign In for Pricing
View Details
MED19/LCMR1 Rabbit Polyclonal Antibody (Cy7)
orb1073595 100 µL

MED19/LCMR1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details