Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLOCK Rabbit Polyclonal Antibody (HRP)

CLOCK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KAT13D, bHLHe8

UniProt

O15516

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CLOCK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004889

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYH (MUTYH) (NM_001048174) Human Tagged ORF Clone Lentiviral Particle
RC201376L3V 200 µL

MYH (MUTYH) (NM_001048174) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ADAM2 (NM_001464) Human Over-expression Lysate
LC419910 20 µg

ADAM2 (NM_001464) Human Over-expression Lysate

Sign In for Pricing
View Details
LCE3D (NM_032563) Human Recombinant Protein
TP311021M 100 µg

LCE3D (NM_032563) Human Recombinant Protein

Sign In for Pricing
View Details
GTF2F1 Rabbit pAb
E45R29530N 50 ul

GTF2F1 Rabbit pAb

Sign In for Pricing
View Details
Mouse Lipoyltransferase 1, Mitochondrial (LIPT1) ELISA Kit
MBS9353379-01 48 Well

Mouse Lipoyltransferase 1, Mitochondrial (LIPT1) ELISA Kit

Sign In for Pricing
View Details
Mouse Lipoyltransferase 1, Mitochondrial (LIPT1) ELISA Kit
MBS9353379-02 96 Well

Mouse Lipoyltransferase 1, Mitochondrial (LIPT1) ELISA Kit

Sign In for Pricing
View Details