Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIR1 Rabbit Polyclonal Antibody (HRP)

CIR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CIR

UniProt

Q86X95

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CIR1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004873

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cpeb4 shRNA (UAS) - Lentiviral mouse Cpeb4 shRNA (UAS, RFP) (100)
GTR15187200 1 Vial

Lentiviral mouse Cpeb4 shRNA (UAS) - Lentiviral mouse Cpeb4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Lentiviral human LMNTD1 shRNA (UAS) - Lentiviral human LMNTD1 shRNA (UAS, GFP) (25)
GTR15336947 1 Vial

Lentiviral human LMNTD1 shRNA (UAS) - Lentiviral human LMNTD1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Dengue virus (DENV) (type 1, strain US/Hawaii/1944) E/Envelope Insect Cells Cell Lysate (WB positive control)
MBS8116132-01 0.3 mg

Dengue virus (DENV) (type 1, strain US/Hawaii/1944) E/Envelope Insect Cells Cell Lysate (WB positive control)

Sign In for Pricing
View Details
Dengue virus (DENV) (type 1, strain US/Hawaii/1944) E/Envelope Insect Cells Cell Lysate (WB positive control)
MBS8116132-02 5x 0.3 mg

Dengue virus (DENV) (type 1, strain US/Hawaii/1944) E/Envelope Insect Cells Cell Lysate (WB positive control)

Sign In for Pricing
View Details
Human MYH8 ELISA Kit (Ready to Use)
orb551623-01 48 Tests

Human MYH8 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human MYH8 ELISA Kit (Ready to Use)
orb551623-02 96 Tests

Human MYH8 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details