Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED26 Rabbit Polyclonal Antibody (HRP)

MED26 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CRSP7, CRSP70

UniProt

O95402

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MED26

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004822

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCCC1 siRNA Oligos set (Human)
28204171 3x 5 nmol

MCCC1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Hamster Chloride Intracellular Channel Protein 4 ELISA Kit
MBS073787-01 48 Well

Hamster Chloride Intracellular Channel Protein 4 ELISA Kit

Sign In for Pricing
View Details
Hamster Chloride Intracellular Channel Protein 4 ELISA Kit
MBS073787-02 96 Well

Hamster Chloride Intracellular Channel Protein 4 ELISA Kit

Sign In for Pricing
View Details
Hamster Chloride Intracellular Channel Protein 4 ELISA Kit
MBS073787-03 5x 96 Well

Hamster Chloride Intracellular Channel Protein 4 ELISA Kit

Sign In for Pricing
View Details
Hamster Chloride Intracellular Channel Protein 4 ELISA Kit
MBS073787-04 10x 96 Well

Hamster Chloride Intracellular Channel Protein 4 ELISA Kit

Sign In for Pricing
View Details
AFVOER (ZUUR) 450X52RL-T1-LL-P22 Pipe Markers for Acids & Bases
N006419 30 Pack (30 Marker (s) x 1 Roll)

AFVOER (ZUUR) 450X52RL-T1-LL-P22 Pipe Markers for Acids & Bases

Sign In for Pricing
View Details