Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAND1 Rabbit Polyclonal Antibody (Biotin)

HAND1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Hxt, eHand, Thing1, bHLHa27

UniProt

O96004

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HAND1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_004812

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant other HSA Protein, Untagged, Pichia Pastoris-10mg
QP12314-10mg 10mg

Recombinant other HSA Protein, Untagged, Pichia Pastoris-10mg

Sign In for Pricing
View Details
Human SIGLEC18P qPCR Primer Pair
QH59469S 200 Tests

Human SIGLEC18P qPCR Primer Pair

Sign In for Pricing
View Details
S100A11 Rabbit Polyclonal Antibody (BF488)
orb2553222 100 µL

S100A11 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Anti-h PRL 5601 SP-5
MBS5680524-01 1 mg

Anti-h PRL 5601 SP-5

Sign In for Pricing
View Details
Anti-h PRL 5601 SP-5
MBS5680524-02 5x 1 mg

Anti-h PRL 5601 SP-5

Sign In for Pricing
View Details
PE/Texas Red® Anti-dog/ chicken/ rabbit/ guinea pig/ horse/ cow/ mouse/ rat/ pig/ non-human primates/ human CD79a Antibody *HM47*
107901U1-AAT 100 Tests

PE/Texas Red® Anti-dog/ chicken/ rabbit/ guinea pig/ horse/ cow/ mouse/ rat/ pig/ non-human primates/ human CD79a Antibody *HM47*

Sign In for Pricing
View Details