Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP16 Rabbit Polyclonal Antibody (HRP)

PARP16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARTD15, pART15, C15orf30

UniProt

Q6PK64

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PARP16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_060321

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F11 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6737103 1.0 µg DNA

F11 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Olr1344 Protein Lysate (Rat) with C-HA Tag
33856036 100 µg

Olr1344 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Rat Anti-Mouse CD71 mAb (PerCP/Cy5.5) [R17 217.1.3/TIB-219]
E2781244 100 Tests

Rat Anti-Mouse CD71 mAb (PerCP/Cy5.5) [R17 217.1.3/TIB-219]

Sign In for Pricing
View Details
Rabbit anti Photobacterium fischeri NADH-FMN Oxidoreductase, conjugated with Biotin
MBS573517-01 1 mL

Rabbit anti Photobacterium fischeri NADH-FMN Oxidoreductase, conjugated with Biotin

Sign In for Pricing
View Details
Rabbit anti Photobacterium fischeri NADH-FMN Oxidoreductase, conjugated with Biotin
MBS573517-02 5x 1 mL

Rabbit anti Photobacterium fischeri NADH-FMN Oxidoreductase, conjugated with Biotin

Sign In for Pricing
View Details
Anti-Human ROR1/NTRKR1 Antibody (2A4)
MBS1572192-01 0.1 mg

Anti-Human ROR1/NTRKR1 Antibody (2A4)

Sign In for Pricing
View Details