Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP16 Rabbit Polyclonal Antibody (HRP)

PARP16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARTD15, pART15, C15orf30

UniProt

Q6PK64

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PARP16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_060321

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LYSMD3 shRNA (UAS) - Lentiviral human LYSMD3 shRNA (UAS, RFP) (100)
GTR15118344 1 Vial

Lentiviral human LYSMD3 shRNA (UAS) - Lentiviral human LYSMD3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Lentiviral mouse Cd27 shRNA (UAS) - Lentiviral mouse Cd27 shRNA (UAS, GFP) (100)
GTR15175749 1 Vial

Lentiviral mouse Cd27 shRNA (UAS) - Lentiviral mouse Cd27 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Lentiviral mouse Tbc1d20 shRNA (UAS) - Lentiviral mouse Tbc1d20 shRNA (UAS) plasmid
GTR15296842 1 Vial

Lentiviral mouse Tbc1d20 shRNA (UAS) - Lentiviral mouse Tbc1d20 shRNA (UAS) plasmid

Sign In for Pricing
View Details
ZFHX4 Protein Vector (Mouse) (pPM-C-HA)
50830024 500 ng

ZFHX4 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Hp Pre-designed siRNA Set A
SI106332A 1 Each

Mouse Hp Pre-designed siRNA Set A

Sign In for Pricing
View Details
ERCC6L2 Antibody
A15587-100UG 100 µg

ERCC6L2 Antibody

Sign In for Pricing
View Details