Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP6 Rabbit Polyclonal Antibody (HRP)

PARP6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARTD17, pART17, PARP-6-C, PARP-6-B1

UniProt

Q9HAF3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PARP6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNK

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064599

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOS2 Antibody
E18-5237-2 100 µg -100 µL

SOS2 Antibody

Sign In for Pricing
View Details
PGC Monoclonal Antibody, AbBy Fluor™ 647 Conjugated
bsm-25702M-BF647 100 µL

PGC Monoclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
HSP27 (phospho Ser78) Polyclonal Antibody
UB-GEN-3442 100 µL

HSP27 (phospho Ser78) Polyclonal Antibody

Sign In for Pricing
View Details
DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8, DEAH Box Protein 8, DHX-8, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 8, DDX8, DDX-8, HRH1, Human RNA Helicase 1, PRP22, PRPF22) (MaxLight 405) discontinued
125838-ML405 100 µL

DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8, DEAH Box Protein 8, DHX-8, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 8, DDX8, DDX-8, HRH1, Human RNA Helicase 1, PRP22, PRPF22) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Advanced Reverse Transcriptase (200 U/μL)
orb3032397-01 10000 U

Advanced Reverse Transcriptase (200 U/μL)

Sign In for Pricing
View Details
Advanced Reverse Transcriptase (200 U/μL)
orb3032397-02 50000 U

Advanced Reverse Transcriptase (200 U/μL)

Sign In for Pricing
View Details