Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP11 Rabbit Polyclonal Antibody (FITC)

PARP11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ARTD11, MIB006, C12orf6

UniProt

Q9NR21

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PARP11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065100

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Leprae metX Protein (aa 1-382) (strain Br4923)
VAng-Yyj2085-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Leprae metX Protein (aa 1-382) (strain Br4923)

Sign In for Pricing
View Details
Endothelin 3 (EDN3) (NM_207032) Human Tagged Lenti ORF Clone
RC208777L3 10 µg

Endothelin 3 (EDN3) (NM_207032) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Graphene Oxide Dispersion 1-5 Layers
NM000031-01 100 mL

Graphene Oxide Dispersion 1-5 Layers

Sign In for Pricing
View Details
Graphene Oxide Dispersion 1-5 Layers
NM000031-02 200 mL

Graphene Oxide Dispersion 1-5 Layers

Sign In for Pricing
View Details
Graphene Oxide Dispersion 1-5 Layers
NM000031-03 500 mL

Graphene Oxide Dispersion 1-5 Layers

Sign In for Pricing
View Details
ZAP70 (Zeta Chain Associated Protein Kinase 70kD, FLJ17670, FLJ17679, SRK, STD, TZK, ZAP-70) discontinued
214210-01 20 µL

ZAP70 (Zeta Chain Associated Protein Kinase 70kD, FLJ17670, FLJ17679, SRK, STD, TZK, ZAP-70) discontinued

Sign In for Pricing
View Details