Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP11 Rabbit Polyclonal Antibody (HRP)

PARP11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARTD11, MIB006, C12orf6

UniProt

Q9NR21

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PARP11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065100

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS706217 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS801785 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), CF488A conjugate, 0.1mg/mL
BNC881136-100 1x 100 µL

Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIRPB2 (NM_001122962) Human Over-expression Lysate
LC426589 20 µg

SIRPB2 (NM_001122962) Human Over-expression Lysate

Sign In for Pricing
View Details
Zinc finger protein 30 (ZNF30) (N-term) Rabbit Polyclonal Antibody
AP54687PU-N 400 µL

Zinc finger protein 30 (ZNF30) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human LFA-3/CD58 Protein (Fc Tag)
PKSH030847 100 µg

Recombinant Human LFA-3/CD58 Protein (Fc Tag)

Sign In for Pricing
View Details