Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP11 Rabbit Polyclonal Antibody (Biotin)

PARP11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARTD11, MIB006, C12orf6

UniProt

Q9NR21

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PARP11

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065100

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Plcl2 activation kit by CRISPRa
GA213736 1 Kit

Mouse Plcl2 activation kit by CRISPRa

Sign In for Pricing
View Details
Inhba Mouse shRNA Lentiviral Particle (Locus ID 16323)
TL516955V 500 µL Each

Inhba Mouse shRNA Lentiviral Particle (Locus ID 16323)

Sign In for Pricing
View Details
Cytokeratin 19 Rabbit mAb
AB101881 100 µL

Cytokeratin 19 Rabbit mAb

Sign In for Pricing
View Details
DLL3 Antibody (C-term) [APR11752G]
APR11752G-01 50 µL

DLL3 Antibody (C-term) [APR11752G]

Sign In for Pricing
View Details
DLL3 Antibody (C-term) [APR11752G]
APR11752G-02 100 µL

DLL3 Antibody (C-term) [APR11752G]

Sign In for Pricing
View Details
DLL3 Antibody (C-term) [APR11752G]
APR11752G-03 200 µL

DLL3 Antibody (C-term) [APR11752G]

Sign In for Pricing
View Details