Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP8 Rabbit Polyclonal Antibody (HRP)

PARP8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARTD16, pART16

UniProt

Q8N3A8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKDEPASSSKSSNTSQSQKKGQQSQFLQSRNLKCIALCEVITSSDLHKHG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

96kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078891

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NME2 Protein
ARP3158-01 10 µg

Recombinant Human NME2 Protein

Sign In for Pricing
View Details
Recombinant Human NME2 Protein
ARP3158-02 50 µg

Recombinant Human NME2 Protein

Sign In for Pricing
View Details
Recombinant Human NME2 Protein
ARP3158-03 100 µg

Recombinant Human NME2 Protein

Sign In for Pricing
View Details
Recombinant Human NME2 Protein
ARP3158-04 1 mg

Recombinant Human NME2 Protein

Sign In for Pricing
View Details
Phospho-Bcl-xL (Ser62) Rabbit Polyclonal Antibody
orb312836-01 50 μL

Phospho-Bcl-xL (Ser62) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Bcl-xL (Ser62) Rabbit Polyclonal Antibody
orb312836-02 100 µL

Phospho-Bcl-xL (Ser62) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details