Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP9 Rabbit Polyclonal Antibody (Biotin)

PARP9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BAL, BAL1, ARTD9, MGC:7868

UniProt

Q8IXQ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PARP9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

96kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_113646

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR320D2 ORF Vector (Human) (pORF)
ORF024029 1.0 µg DNA

MIR320D2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Stard13 ORF Vector (Mouse) (pORF)
ORF058637 1.0 µg DNA

Stard13 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Transcriptional enhancer Factor TEF-1 (TEAD1) Human ELISA Kit
H7531 96 Tests

Transcriptional enhancer Factor TEF-1 (TEAD1) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Mediator of RNA polymerase II transcription subunit 4 (MED4)
MBS1455328-01 0.05 mg (E-Coli)

Recombinant Kluyveromyces lactis Mediator of RNA polymerase II transcription subunit 4 (MED4)

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Mediator of RNA polymerase II transcription subunit 4 (MED4)
MBS1455328-02 0.05 mg (Yeast)

Recombinant Kluyveromyces lactis Mediator of RNA polymerase II transcription subunit 4 (MED4)

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Mediator of RNA polymerase II transcription subunit 4 (MED4)
MBS1455328-03 0.2 mg (E-Coli)

Recombinant Kluyveromyces lactis Mediator of RNA polymerase II transcription subunit 4 (MED4)

Sign In for Pricing
View Details