Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP6 Rabbit Polyclonal Antibody (HRP)

PARP6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARTD17, pART17, PARP-6-C, PARP-6-B1

UniProt

Q2NL67

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PARP6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064599

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-518e-5p miRNA Inhibitor
MBS8293498-01 10 nmol

hsa-miR-518e-5p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-518e-5p miRNA Inhibitor
MBS8293498-02 20 nmol

hsa-miR-518e-5p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-518e-5p miRNA Inhibitor
MBS8293498-03 5x 20 nmol

hsa-miR-518e-5p miRNA Inhibitor

Sign In for Pricing
View Details
Slc22a8 Mouse shRNA Lentiviral Particle (Locus ID 19879)
TL514583V 500 µL Each

Slc22a8 Mouse shRNA Lentiviral Particle (Locus ID 19879)

Sign In for Pricing
View Details
Fam149b 3'UTR GFP Stable Cell Line
TU156158 1.0 mL

Fam149b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Nm23-H2 (h) -PR
sc-40774-PR 10 µM - 20 µL

Nm23-H2 (h) -PR

Sign In for Pricing
View Details