Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XK Rabbit Polyclonal Antibody (HRP)

XK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KX, NA, NAC, X1k, XKR1

UniProt

P51811

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human XK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_066569

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTP4A3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
38138154 3x 1.0 µg DNA

PTP4A3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
ACYP1 (Acylphosphatase-1, Acylphosphatase Erythrocyte Isozyme, ACYPE, Acylphosphatase Organ-common Type Isozyme, Acylphosphate Phosphohydrolase 1) (Biotin)
MBS6140476-01 0.1 mL

ACYP1 (Acylphosphatase-1, Acylphosphatase Erythrocyte Isozyme, ACYPE, Acylphosphatase Organ-common Type Isozyme, Acylphosphate Phosphohydrolase 1) (Biotin)

Sign In for Pricing
View Details
ACYP1 (Acylphosphatase-1, Acylphosphatase Erythrocyte Isozyme, ACYPE, Acylphosphatase Organ-common Type Isozyme, Acylphosphate Phosphohydrolase 1) (Biotin)
MBS6140476-02 5x 0.1 mL

ACYP1 (Acylphosphatase-1, Acylphosphatase Erythrocyte Isozyme, ACYPE, Acylphosphatase Organ-common Type Isozyme, Acylphosphate Phosphohydrolase 1) (Biotin)

Sign In for Pricing
View Details
1- (4-Chlorophenyl) guanidine
FC64080 1 g

1- (4-Chlorophenyl) guanidine

Sign In for Pricing
View Details
Rat Cytokeratin 18 CK 18 ELISA Kit
BG-RAT10692 1 Each

Rat Cytokeratin 18 CK 18 ELISA Kit

Sign In for Pricing
View Details
Idax HDR Plasmid (h)
sc-408286-HDR 20 µg

Idax HDR Plasmid (h)

Sign In for Pricing
View Details