Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XK Rabbit Polyclonal Antibody (FITC)

XK Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KX, NA, NAC, X1k, XKR1

UniProt

P51811

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human XK

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QMPKNGLSEEIEKEVGQAEGKLITHRSAFSRASVIQAFLGSAPQLTLQLY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_066569

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD314 Mouse Monoclonal Antibody
TD-31916 100 µL

CD314 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Elastin (ELN) (NM_001081753) Human Untagged Clone
SC316018 10 µg

Elastin (ELN) (NM_001081753) Human Untagged Clone

Sign In for Pricing
View Details
PAWP78-PVCpnf_pvc13-antiHistoneNb Plasmid
PVT67146 2 µg

PAWP78-PVCpnf_pvc13-antiHistoneNb Plasmid

Sign In for Pricing
View Details
Arpc1b AAV siRNA Pooled Vector
12434166 1.0 µg

Arpc1b AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Spinacia oleracea Photosystem I reaction center subunit XI, chloroplastic (PSAL)
orb2930753-01 20 µg

Recombinant Spinacia oleracea Photosystem I reaction center subunit XI, chloroplastic (PSAL)

Sign In for Pricing
View Details
Recombinant Spinacia oleracea Photosystem I reaction center subunit XI, chloroplastic (PSAL)
orb2930753-02 100 µg

Recombinant Spinacia oleracea Photosystem I reaction center subunit XI, chloroplastic (PSAL)

Sign In for Pricing
View Details