Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XK Rabbit Polyclonal Antibody (HRP)

XK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KX, NA, NAC, X1k, XKR1

UniProt

P51811

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human XK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QMPKNGLSEEIEKEVGQAEGKLITHRSAFSRASVIQAFLGSAPQLTLQLY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_066569

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM81 Pre-designed siRNA Set A
SI017000A 1 Each

Human TMEM81 Pre-designed siRNA Set A

Sign In for Pricing
View Details
N, N'-1,2-ethanediylidenebis (2-methyl-2-Propanamine
JH250476 1 Each

N, N'-1,2-ethanediylidenebis (2-methyl-2-Propanamine

Sign In for Pricing
View Details
Nori® Mouse NGF-B ELISA Kit
GR117310 96 Well

Nori® Mouse NGF-B ELISA Kit

Sign In for Pricing
View Details
CKAP2L Antibody, Biotin conjugated
CSB-PA809015LD01HU-01 50 µg

CKAP2L Antibody, Biotin conjugated

Sign In for Pricing
View Details
CKAP2L Antibody, Biotin conjugated
CSB-PA809015LD01HU-02 100 µg

CKAP2L Antibody, Biotin conjugated

Sign In for Pricing
View Details
Multiplex Assay Kit for Brain Abundant, Membrane Attached Signal Protein 1 (BASP1), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031501 96 Tests

Multiplex Assay Kit for Brain Abundant, Membrane Attached Signal Protein 1 (BASP1), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details