Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTRB1 Rabbit Polyclonal Antibody (HRP)

CTRB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CTRB

UniProt

P17538

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CTRB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001897

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti CAPN1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8422957-01 0.12 mL

Rabbit Anti CAPN1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
Rabbit Anti CAPN1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8422957-02 0.2 mL

Rabbit Anti CAPN1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
Rabbit Anti CAPN1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8422957-03 5x 0.2 mL

Rabbit Anti CAPN1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
Integrin beta 2 Antibody, mAb, Rabbit
A03620-100 100 µL

Integrin beta 2 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
LRP5 Peptide
orb1233925 0.1 mg

LRP5 Peptide

Sign In for Pricing
View Details
Anti-CD152/CTLA4 Polyclonal antibody
ARO-A14103-01 50 µg

Anti-CD152/CTLA4 Polyclonal antibody

Sign In for Pricing
View Details