Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK1 Rabbit Polyclonal Antibody (HRP)

PCSK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PC1, PC3, NEC1, SPC3, BMIQ12

UniProt

P29120

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PCSK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000430

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vitamin D Receptor (VDR) Mini Samples ELISA Kit
MBS2087402-01 24 Strip Well

Mouse Vitamin D Receptor (VDR) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Vitamin D Receptor (VDR) Mini Samples ELISA Kit
MBS2087402-02 48 Well

Mouse Vitamin D Receptor (VDR) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Vitamin D Receptor (VDR) Mini Samples ELISA Kit
MBS2087402-03 96 Well

Mouse Vitamin D Receptor (VDR) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Vitamin D Receptor (VDR) Mini Samples ELISA Kit
MBS2087402-04 5x 96 Well

Mouse Vitamin D Receptor (VDR) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Vitamin D Receptor (VDR) Mini Samples ELISA Kit
MBS2087402-05 10x 96 Well

Mouse Vitamin D Receptor (VDR) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Eukaryotic Villin (VIL)
MBS2140068-01 0.01 mg

Eukaryotic Villin (VIL)

Sign In for Pricing
View Details