Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTRL Rabbit Polyclonal Antibody (HRP)

CTRL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CTRL1

UniProt

P40313

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CTRL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001898

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam3a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6578005 3x 1.0 µg

Fam3a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
ZFYVE1, NT (ZFYVE1, DFCP1, KIAA1589, TAFF1, ZNFN2A1, Zinc finger FYVE domain-containing protein 1, Double FYVE-containing protein 1, SR3, Tandem FYVE fingers-1) (PE)
MBS6365259-01 0.2 mL

ZFYVE1, NT (ZFYVE1, DFCP1, KIAA1589, TAFF1, ZNFN2A1, Zinc finger FYVE domain-containing protein 1, Double FYVE-containing protein 1, SR3, Tandem FYVE fingers-1) (PE)

Sign In for Pricing
View Details
ZFYVE1, NT (ZFYVE1, DFCP1, KIAA1589, TAFF1, ZNFN2A1, Zinc finger FYVE domain-containing protein 1, Double FYVE-containing protein 1, SR3, Tandem FYVE fingers-1) (PE)
MBS6365259-02 5x 0.2 mL

ZFYVE1, NT (ZFYVE1, DFCP1, KIAA1589, TAFF1, ZNFN2A1, Zinc finger FYVE domain-containing protein 1, Double FYVE-containing protein 1, SR3, Tandem FYVE fingers-1) (PE)

Sign In for Pricing
View Details
Α-amylase 2B (AMY2B) Human ELISA Kit
B4070 96 Tests

Α-amylase 2B (AMY2B) Human ELISA Kit

Sign In for Pricing
View Details
Nitronium tetrafluoroborate 96%
N10210-01 5 g

Nitronium tetrafluoroborate 96%

Sign In for Pricing
View Details
Nitronium tetrafluoroborate 96%
N10210-02 25 g

Nitronium tetrafluoroborate 96%

Sign In for Pricing
View Details