Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fgf1 Rabbit Polyclonal Antibody (HRP)

Fgf1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FGF-1, Fgf2b, HBGF1, HBGF-1

UniProt

P61149

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTR

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_036978

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RPA2 Protein, N-His
bs-103829P-01 20 µg

Recombinant Human RPA2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RPA2 Protein, N-His
bs-103829P-02 50 µg

Recombinant Human RPA2 Protein, N-His

Sign In for Pricing
View Details
Gpr56 siRNA Oligos set (Rat)
22574176 3x 5 nmol

Gpr56 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
ARL5A CRISPRa sgRNA lentivector (set of three targets)(Rat)
12394126 3x 1.0µg DNA

ARL5A CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
RERG sgRNA CRISPR Lentivector (Human) (Target 1)
K1809502 1.0 µg DNA

RERG sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PI 3 Kinase Class 3 Polyclonal Antibody
MBS8532418-01 0.1 mg

PI 3 Kinase Class 3 Polyclonal Antibody

Sign In for Pricing
View Details