Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF3A Rabbit Polyclonal Antibody (FITC)

KIF3A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLA10, KLP-20

UniProt

Q9Y496

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KIF3A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_008985

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA-3 (Breast and Urothelial Marker) (GATA3/2445), Biotin conjugate, 0.1mg/mL
BNCB2445-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2445), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat Fcγ RIIB/CD32b Protein (Fc Tag)
PDMR100074-01 20 µg

Recombinant Rat Fcγ RIIB/CD32b Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat Fcγ RIIB/CD32b Protein (Fc Tag)
PDMR100074-02 100 µg

Recombinant Rat Fcγ RIIB/CD32b Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat Fcγ RIIB/CD32b Protein (Fc Tag)
PDMR100074-03 500 µg

Recombinant Rat Fcγ RIIB/CD32b Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat Fcγ RIIB/CD32b Protein (Fc Tag)
PDMR100074-04 1 mg

Recombinant Rat Fcγ RIIB/CD32b Protein (Fc Tag)

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), 0.2mg/mL
BNUB2151-100 1x 100 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), 0.2mg/mL

Sign In for Pricing
View Details