Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF3A Rabbit Polyclonal Antibody (HRP)

KIF3A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLA10, KLP-20

UniProt

Q9Y496

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KIF3A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_008985

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBX2 Human Gene Knockout Kit (CRISPR)
KN416313 1 Kit

CBX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), CF647 conjugate, 0.1mg/mL
BNC472113-500 1x 500 µL

Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NF-L Recombinant Chimeric Antibody Antibody
HA601448 100 µL

NF-L Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS802285 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
CD68 (C68/684), CF640R conjugate, 0.1mg/mL
BNC400684-500 1x 500 µL

CD68 (C68/684), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CEP192 Human Gene Knockout Kit (CRISPR)
KN417445 1 Kit

CEP192 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details