Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF22 Rabbit Polyclonal Antibody (FITC)

KIF22 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KID, OBP, KNSL4, OBP-1, OBP-2, SEMDJL2, A-328A3.2

UniProt

Q14807

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KIF22

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_015556

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Riboflow One Bouiilon Listeria - Supplement only (vial q.s. per 500 ml medium) 10 vials
41-472200_OXSUP 10 Vials

Riboflow One Bouiilon Listeria - Supplement only (vial q.s. per 500 ml medium) 10 vials

Sign In for Pricing
View Details
C-flat 2/2 on 400 copper mesh
orb653847 50 PCS

C-flat 2/2 on 400 copper mesh

Sign In for Pricing
View Details
Pack of 1000 Discs of Non Woven Filter 110G/M², 47 Mm
NT110A0047M Pack of 1000

Pack of 1000 Discs of Non Woven Filter 110G/M², 47 Mm

Sign In for Pricing
View Details
Anti-Inhibin beta E Antibody
CPA7323-01 30 µL

Anti-Inhibin beta E Antibody

Sign In for Pricing
View Details
Anti-Inhibin beta E Antibody
CPA7323-02 50 μL

Anti-Inhibin beta E Antibody

Sign In for Pricing
View Details
Anti-Inhibin beta E Antibody
CPA7323-03 100 µL

Anti-Inhibin beta E Antibody

Sign In for Pricing
View Details