Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF22 Rabbit Polyclonal Antibody (HRP)

KIF22 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KID, OBP, KNSL4, OBP-1, OBP-2, SEMDJL2, A-328A3.2

UniProt

Q14807

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KIF22

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_015556

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Myometrium
CS500487 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
Epidermal growth factor receptor Antibody (EGFR)
F50597-0.08ML 0.08 mL

Epidermal growth factor receptor Antibody (EGFR)

Sign In for Pricing
View Details
IF 2(Mt) (MTIF2) (NM_002453) Human Over-expression Lysate
LY419315 100 µg

IF 2(Mt) (MTIF2) (NM_002453) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human IL10RB/IL10R2 Protein (His & Fc Tag)
PKSH031342 100 µg

Recombinant Human IL10RB/IL10R2 Protein (His & Fc Tag)

Sign In for Pricing
View Details
Human NFU1 activation kit by CRISPRa
GA109083 1 Kit

Human NFU1 activation kit by CRISPRa

Sign In for Pricing
View Details
ADAMTS1 Rabbit Polyclonal Antibody
TA371637 100 µL

ADAMTS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details