Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF22 Rabbit Polyclonal Antibody (Biotin)

KIF22 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KID, OBP, KNSL4, OBP-1, OBP-2, SEMDJL2, A-328A3.2

UniProt

Q14807

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KIF22

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_015556

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 Rabbit pAb, Cy3 conjugated
orb2838217 100 µL

CD20 Rabbit pAb, Cy3 conjugated

Sign In for Pricing
View Details
Liver FABP Polyclonal Antibody, APC Conjugated
bs-0897R-APC 100 µL

Liver FABP Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Olfm1 shRNA (UAS) - Lentiviral mouse Olfm1 shRNA (UAS, GFP) plasmid
GTR15191986 1 Vial

Lentiviral mouse Olfm1 shRNA (UAS) - Lentiviral mouse Olfm1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Eif5a Rat Pre-designed siRNA Set A
HY-RS26171 1 Set

Eif5a Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
LOC100504458 3'UTR Luciferase Stable Cell Line
TU112062 1.0 mL

LOC100504458 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lppr2 Protein Vector (Human) (pPM-C-HA)
PV024215 500 ng

Lppr2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details