Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF25 Rabbit Polyclonal Antibody (HRP)

KIF25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KNSL3

UniProt

Q9UIL4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KIF25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_085118

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ATP binding cassette sub family B member 6, mitochondrial (ABCB6) ELISA Kit
MBS7240700-01 48 Well

Human ATP binding cassette sub family B member 6, mitochondrial (ABCB6) ELISA Kit

Sign In for Pricing
View Details
Human ATP binding cassette sub family B member 6, mitochondrial (ABCB6) ELISA Kit
MBS7240700-02 96 Well

Human ATP binding cassette sub family B member 6, mitochondrial (ABCB6) ELISA Kit

Sign In for Pricing
View Details
Human ATP binding cassette sub family B member 6, mitochondrial (ABCB6) ELISA Kit
MBS7240700-03 5x 96 Well

Human ATP binding cassette sub family B member 6, mitochondrial (ABCB6) ELISA Kit

Sign In for Pricing
View Details
Human ATP binding cassette sub family B member 6, mitochondrial (ABCB6) ELISA Kit
MBS7240700-04 10x 96 Well

Human ATP binding cassette sub family B member 6, mitochondrial (ABCB6) ELISA Kit

Sign In for Pricing
View Details
CXCL2/GRO Beta Rabbit Polyclonal Antibody
orb10749-01 50 μL

CXCL2/GRO Beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CXCL2/GRO Beta Rabbit Polyclonal Antibody
orb10749-02 100 µL

CXCL2/GRO Beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details