Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF2B Rabbit Polyclonal Antibody (Biotin)

KIF2B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8N4N8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIF2B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115948

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neuropeptide B,NPB ELISA KIT
JOT-EK7525Hu-01 48 Well

Human Neuropeptide B,NPB ELISA KIT

Sign In for Pricing
View Details
Human Neuropeptide B,NPB ELISA KIT
JOT-EK7525Hu-02 96 Well

Human Neuropeptide B,NPB ELISA KIT

Sign In for Pricing
View Details
7-α-Hydroxycholest-4-en-3-one 12-α-Hydroxylase (CYP8B1) Rabbit ELISA Kit
B1493 96 Tests

7-α-Hydroxycholest-4-en-3-one 12-α-Hydroxylase (CYP8B1) Rabbit ELISA Kit

Sign In for Pricing
View Details
Human ELFN1 Pre-designed siRNA Set A
SI004898A 1 Each

Human ELFN1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-TRMT5 Antibody Picoband®, APC Conjugate
A11359-1-APC 100 µg/Vial

Anti-TRMT5 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Lentiviral human RNF133 sgRNA gene knockout kit - Lentiviral human RNF133 sgRNA gene knockout kit (25)
GTR15373131 1 Vial

Lentiviral human RNF133 sgRNA gene knockout kit - Lentiviral human RNF133 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details