Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF9 Rabbit Polyclonal Antibody (FITC)

KIF9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC104186

UniProt

Q9HAQ2

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of human KIF9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_878905

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAN (Aggrecan Core Protein, Cartilage-specific Proteoglycan Core Protein, CSPCP, Chondroitin Sulfate Proteoglycan Core Protein 1, Chondroitin Sulfate Proteoglycan 1, AGC1, CSPG1, MSK16) discontinued
359732-01 50 µL

ACAN (Aggrecan Core Protein, Cartilage-specific Proteoglycan Core Protein, CSPCP, Chondroitin Sulfate Proteoglycan Core Protein 1, Chondroitin Sulfate Proteoglycan 1, AGC1, CSPG1, MSK16) discontinued

Sign In for Pricing
View Details
ACAN (Aggrecan Core Protein, Cartilage-specific Proteoglycan Core Protein, CSPCP, Chondroitin Sulfate Proteoglycan Core Protein 1, Chondroitin Sulfate Proteoglycan 1, AGC1, CSPG1, MSK16) discontinued
359732-02 100 µL

ACAN (Aggrecan Core Protein, Cartilage-specific Proteoglycan Core Protein, CSPCP, Chondroitin Sulfate Proteoglycan Core Protein 1, Chondroitin Sulfate Proteoglycan 1, AGC1, CSPG1, MSK16) discontinued

Sign In for Pricing
View Details
RPL26L1 Recombinant Antibody, FITC Conjugated
bsm-62558R-FITC-01 20 µL

RPL26L1 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
RPL26L1 Recombinant Antibody, FITC Conjugated
bsm-62558R-FITC-02 100 µL

RPL26L1 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
CD2 mouse mAb(ABT-CD2)
UB-GEN-14997 100 µL

CD2 mouse mAb(ABT-CD2)

Sign In for Pricing
View Details
Nuclear Factor Kappa B2 (NFkB2) Antibody (FITC)
abx273915-01 200 µL

Nuclear Factor Kappa B2 (NFkB2) Antibody (FITC)

Sign In for Pricing
View Details