Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF9 Rabbit Polyclonal Antibody (HRP)

KIF9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC104186

UniProt

Q9HAQ2

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of human KIF9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_878905

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Reticulocalbin 1
7-06087 1 mg

Recombinant Human Reticulocalbin 1

Sign In for Pricing
View Details
L-ficolin (FCN219) FITC
sc-130297 FITC 200 µg/mL

L-ficolin (FCN219) FITC

Sign In for Pricing
View Details
FoxM1 (D3F2B) Rabbit Monoclonal Antibody (Flow Formulated)
CST 54236T 20 µL

FoxM1 (D3F2B) Rabbit Monoclonal Antibody (Flow Formulated)

Sign In for Pricing
View Details
Influenza B Nucleoprotein (HRP)
I7651-01L-HRP 100 µL

Influenza B Nucleoprotein (HRP)

Sign In for Pricing
View Details
Reagecon pH 4.00, pH 7.00 & pH 10.00 Recal Colour Coded Buffer Solutions at 25°C (mixed pack containing 2 of each pH value)
MXC65 6 x 90 mL

Reagecon pH 4.00, pH 7.00 & pH 10.00 Recal Colour Coded Buffer Solutions at 25°C (mixed pack containing 2 of each pH value)

Sign In for Pricing
View Details
DEFB132 Conjugated Antibody
orb1625070 100 µL

DEFB132 Conjugated Antibody

Sign In for Pricing
View Details