Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF9 Rabbit Polyclonal Antibody (FITC)

KIF9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC104186

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of human KIF9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_878906

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ACAD11 activation kit by CRISPRa
GA113382 1 Kit

Human ACAD11 activation kit by CRISPRa

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS1-4), CF640R conjugate, 0.1mg/mL
BNC401745-500 1x 500 µL

Epstein-Barr Virus (LMP-1) (CS1-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vamp2 (NM_009497) Mouse Tagged ORF Clone
MG200490 10 µg

Vamp2 (NM_009497) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ferritin, Heavy Chain (FTH) (Microglia Marker) (FTH/2081), 1mg/mL
BNUM2081-50 1x 50 µL

Ferritin, Heavy Chain (FTH) (Microglia Marker) (FTH/2081), 1mg/mL

Sign In for Pricing
View Details
TMEM215 (NM_212558) Human Recombinant Protein
TP319899M 100 µg

TMEM215 (NM_212558) Human Recombinant Protein

Sign In for Pricing
View Details
PIAS3 (NM_006099) Human Over-expression Lysate
LY401839 100 µg

PIAS3 (NM_006099) Human Over-expression Lysate

Sign In for Pricing
View Details