Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF9 Rabbit Polyclonal Antibody (HRP)

KIF9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC104186

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of human KIF9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_878906

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytochrome P450 3A4 Antibody (P6) [DyLight 680]
NBP2-50207FR 0.1 mL

Mouse Monoclonal Cytochrome P450 3A4 Antibody (P6) [DyLight 680]

Sign In for Pricing
View Details
EWS Conjugated Antibody
orb1629245 100 µL

EWS Conjugated Antibody

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae hemE Protein (aa 1-354)
VAng-Cr4857-1mgEcoli 1 mg (E. coli)

Recombinant Klebsiella Pneumoniae hemE Protein (aa 1-354)

Sign In for Pricing
View Details
pOTB7-SUMO1 Plasmid
PVT29770 2 µg

pOTB7-SUMO1 Plasmid

Sign In for Pricing
View Details
Bovine Platelet-activating factor acetylhydrolase 2, cytoplasmic (PAFAH2) ELISA Kit
MBS2806138-01 48 Tests

Bovine Platelet-activating factor acetylhydrolase 2, cytoplasmic (PAFAH2) ELISA Kit

Sign In for Pricing
View Details
Bovine Platelet-activating factor acetylhydrolase 2, cytoplasmic (PAFAH2) ELISA Kit
MBS2806138-02 96 Tests

Bovine Platelet-activating factor acetylhydrolase 2, cytoplasmic (PAFAH2) ELISA Kit

Sign In for Pricing
View Details