Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNF1B Rabbit Polyclonal Antibody (Biotin)

HNF1B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

T2D, FJHN, HNF2, LFB3, RCAD, TCF2, HPC11, LF-B3, MODY5, TCF-2, VHNF1, ADTKD3, HNF-1B, HNF1beta, HNF-1-beta

UniProt

P35680

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HNF1B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QGNNEITSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMIS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000449

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G3BP1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
21120124 3x 1.0µg DNA

G3BP1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Pleiotrophin (PTN) BioAssayTM ELISA Kit (Rat)
027536 96 Tests

Pleiotrophin (PTN) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details
Zscan12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4950705 3x 1.0 µg

Zscan12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PLIN5 Rabbit Polyclonal Antibody (Fluoro647)
orb3103544 100 µg

PLIN5 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Tulip sp. Lectin (TL) - Pure
30330052-2 10 mg

Tulip sp. Lectin (TL) - Pure

Sign In for Pricing
View Details
Lentiviral mouse Icam5 shRNA (UAS) - Lentiviral mouse Icam5 shRNA (UAS) (100)
GTR15217362 1 Vial

Lentiviral mouse Icam5 shRNA (UAS) - Lentiviral mouse Icam5 shRNA (UAS) (100)

Sign In for Pricing
View Details