Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTRB1 Rabbit Polyclonal Antibody (HRP)

CTRB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CTRB

UniProt

P17538

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CTRB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001897

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCKBR Rabbit Polyclonal Antibody (Cy3)
orb983230 100 µL

CCKBR Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
PIAS2, CT (E3 SUMO-protein Ligase PIAS2, Protein Inhibitor of Activated STAT2, Protein Inhibitor of Activated STAT x, Msx-interacting Zinc Finger Protein, Miz1, DAB2-interacting Protein, DIP, Androgen Receptor-interacting Protein 3, ARIP3, PIAS-NY Protein, PIASX) (MaxLight 650) discontinued
P4085-11B-ML650 100 µL

PIAS2, CT (E3 SUMO-protein Ligase PIAS2, Protein Inhibitor of Activated STAT2, Protein Inhibitor of Activated STAT x, Msx-interacting Zinc Finger Protein, Miz1, DAB2-interacting Protein, DIP, Androgen Receptor-interacting Protein 3, ARIP3, PIAS-NY Protein, PIASX) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Rat IL-21 protein
orb753389-01 50 µg

Rat IL-21 protein

Sign In for Pricing
View Details
Rat IL-21 protein
orb753389-02 100 µg

Rat IL-21 protein

Sign In for Pricing
View Details
Rat IL-21 protein
orb753389-03 200 µg

Rat IL-21 protein

Sign In for Pricing
View Details
Rat IL-21 protein
orb753389-04 1 mg

Rat IL-21 protein

Sign In for Pricing
View Details